Candlelites

Everything from Everywhere

week 2 in review sony unveils three phones galaxy s9 rumors heat up - Search

week 2 in review sony unveils three phones galaxy s9 rumors heat up Searched between all the resources and sites across the web. To view the full text news click on the links searched. All links are displayed with the source site.



week 2 in review: sony unveils three phones, galaxy s9 rumors heat up


despite hosting the consumer electronics show in las vegas, the second week of 2018 didn't bring a lot of phone-related action. the biggest story from ces was synaptics' under-the-screen fingerprint scanner which vivo showcased on a prototype phone, which we handled. it's a solid start, but it's not yet fast enough to compare with current scanners on current phones.our most read article this past week concerned the galaxy s9 and s9+ storage and ram configurations. the s9 will have 4gb of ram and either 64gb or 128gb of storage while the s9+ will use 6gb of ram and adds a 256gb model to the 64gb and 128gb ones. both will unveiled at the mobile world congress in march.the rest of the stories this week are sony's announcement the xperia xa2, xa2 ultra with rear-mounted fingerprint scanners th






bored with the galaxy s8? don't worry, because galaxy s9 rumors are here already


why it matters to you the next galaxy phone is as highly anticipated as the next iphone, and the galaxy s9 is already being discussed in rumors.the galaxy s8 may be the samsung phone to have right now, but in 2018, it will likely be replaced by another phone in the company’s range, which we’d all expect to be named the galaxy s9. although the galaxy s8 is only just reaching store shelves right now, talk has already begun regarding the s9. it’s very early days, but here’s what’s already being rumored for the next galaxy phone.a report published by the korean publication the investor quoting sources speaking to the aju business daily says samsung and qualcomm are teaming up again for the galaxy s9, and the new phone may use a next-generation, and as-yet unconfirmed processor inside. it’s spe






bored of the galaxy s8? don't worry, because galaxy s9 rumors are here already


why it matters to you the next galaxy phone is as highly anticipated as the next iphone, and the galaxy s9 is already being discussed in rumors.the galaxy s8 may be the samsung phone to have right now, but in 2018, it’ll likely be replaced by another phone in the company’s range, which we’d all expect to be named the galaxy s9. although the galaxy s8 is only just reaching store shelves right now, talk has already begun regarding the s9. it’s very early days, but here’s what’s already being rumored for the next galaxy phone.a report published by the korean publication the investor quoting sources speaking to the aju business daily says samsung and qualcomm are teaming up again for the galaxy s9, and the new phone may use a next-generation, and as-yet unconfirmed processor inside. it’s specu






lowkeytech download


download download welcome to lowkeytech, we focus on tech news, reviews, tech tips, tutorials, mobile phones pricelists, mobile tricks and tips. our main objective is to keep publishing great contents that would be of help to others. stay updated to mobile phones pricelist for both new and uk used phones in nigeria. you get the great contender on the following topics: accurate & updated price list. new smartphone price list. uk used smartphone price list. cheap & affordable android phones. tech tips & tricks. tutorials. mobile tricks. how-to's. computer village prices. electronics & gadgets pricelist. sponsored articleswe cover all the latest and most popular android phones & tablets including some of these popular devices: tecno camon c9. tecno phantom 6. tecno phantom 6 plus. all tecno p






next-gen samsung galaxy a5 and galaxy a7 get wi-fi certification


wi-fi alliance just granted the required certification to two samsung phones. the products have model names sm-a530f and sm-a730f, meaning these are the samsung galaxy a5 (2018) and the samsung galaxy a7 (2018).samsung galaxy a5 (2018) and samsung galaxy a7 (2018) wi-fi certificationaccording to the documents provided, both phones will run the android 7.1.1 nougat. although it would be better if they came with oreo out of the box, samsung tends to launch its a series smartphones on older os versions and update them subsequently. back in the beginning of 2017, galaxy a3, galaxy a5 and galaxy a7 all came with marshmallow, but eventually got the upgrade to nougat.the wi-fi certification reveals the galaxy a5 (2018) and the galaxy a7 (2018) are certified for wi-fi 802.11 a/b/g/ac.the new galax






samsung galaxy s8 to shoot 1000 fps videos


samsung galaxy s8 which leaked earlier today in some more photos will stay with its 12 mp camera but will match the sony xperia xz premium for slo-mo videos - it will shoot 1000 fps videos. the iris scanner will also be improved with a tiny 3.7 mp camera for better eye recognition, industry sources revealed.there’s plenty of leaks and rumors about the galaxy s8, but this one sure sounds interesting. the camera is said to retain its 12 mp resolution, but this time the korean company added dram enabling the super high framerates.sony xperia xz premium that was unveiled at mwc 2017 delivers that functionality thanks to the sony’s imx400 sensor but the report says samsung won’t be using the same one.in addition, samsung galaxy s8 will have an 8 mp front camera and another, smaller one - 3.7 mp






samsung galaxy s8 to use sony imx333 camera


the samsung galaxy s8 and s8+ are just two days away but there are still uncertainties to be unearthed. one such puzzle piece is the camera - we know it's a 12mp single camera but not much else.the latest rumor suggests the galaxy star duo will premiere a new sony imx330 sensor - a unit that's not even featured on sony's website. but that's it - the rumor gives only a name and nothing else.next up in s8-related news is the quick launch feature which allows you to quickly open up the camera of a locked galaxy s7 and s7 edge by quickly pressing the home button twice. samsung has reportedly moved the feature to the power button on the side, as seen in the screenshot below.quick launch for the camerathat's about as much camera information we have at the moment. a recent rumor suggested that th






top 10 trending phones of week 44


it was another action packed week in the smartphone world with the iphone x finally going on sale and the razer phone going official. those two are now in our top 3, but they didn't manage to dethrone the oppo f5, which retains the lead. samsung galaxy j7 pro dropped to fourth, ahead of the xiaomi mi a1 and its far more premium sibling - samsung galaxy note8. nokia 6 edged out another phone to debut this week - the xiaomi remdmi y1 - for seventh place. the final two spots are taken by the samsung galaxy j7 prime and the xiaomi redmi 4. this makes it 4 new names among the 10 most popular phones with the nokia 7, xiaomi redmi note 4, sony xperia r1 and the huawei mate 10 pro dropping off. specsgalleryspecsgalleryspecsreviewspecsgalleryspecsreviewspecsreviewspecsreviewspecsgalleryspecsgallery






samsung galaxy s8 to use sony imx333 camera


the samsung galaxy s8 and s8+ are just two days away but there are still uncertainties to be unearthed. one such puzzle piece is the camera - we know it's a 12mp single camera but not much else.the latest rumor suggests the galaxy star duo will premiere a new sony imx333 sensor - a unit that's not even featured on sony's website. but that's it - the rumor gives only a name and nothing else.next up in s8-related news is the quick launch feature which allows you to quickly open up the camera of a locked galaxy s7 and s7 edge by quickly pressing the home button twice. samsung has reportedly moved the feature to the power button on the side, as seen in the screenshot below.quick launch for the camerathat's about as much camera information we have at the moment. a recent rumor suggested that th






top 10 trending phones of week 14


the samsung galaxy s8 immediately rose to the top of the after its announcement last week and it's still showing no signs of slowing down. the redmi 4a put on another brave fight to keep the larger galaxy s8+ in third, meaning the top 3 are completely unchanged this time around.below them the galaxy j7 prime and redmi note 4 traded place and now we have a galaxy-redmi-galaxy-redmi-galaxy sequence in the first half of the chart. the chain is interrupted by two galaxy devices placed at 6th and 7th - the galaxy a5 (2017) and the galaxy s7 edge. the last two positions of the chart are occupied by the moto g5 plus and the galaxy c9 pro, hanging on to the top 10 for another week.specsreviewspecsgalleryspecsreviewspecsreviewspecsgalleryspecsreviewspecsreviewspecsgalleryspecsreviewspecsreview






samsung galaxy s8 smartphone | rumors, news, specs, and more


samsung was riding high when the galaxy s7 officially outsold the iphone 6s and 6s plus, and even more so when the galaxy note 7 came along and impressed everyone — until it went out with a bang. the company is therefore likely to be thrilled to leave 2016 behind and turn its attention to this year’s flagship, which we know as the galaxy s8. lee jae-yong, samsung’s mobile communications vice president, has noted the galaxy s8 will “feature slick design and an improved camera, as well as an enhanced artificial intelligence service.” rumors say there may even be two models.we now know it’s coming at the end of april, and although samsung chose not to officially reveal the galaxy s8 during mobile world congress at the end of february, local reports say some lucky executives did get to see the






samsung galaxy s8 smartphone | rumors, news, specs, and more


samsung was riding high when the galaxy s7 officially outsold the iphone 6s and 6s plus, and even more so when the galaxy note 7 came along and impressed everyone — until it went out with a bang. the company is therefore likely to be thrilled to leave 2016 behind and turn its attention to this year’s flagship, which we know as the galaxy s8. lee jae-yong, samsung’s mobile communications vice president, has noted the galaxy s8 will “feature slick design and an improved camera, as well as an enhanced artificial intelligence service.” rumors say there may even be two models.we now know it’s coming at the end of april, and although samsung chose not to officially reveal the galaxy s8 during mobile world congress at the end of february, local reports say some lucky executives did get to see the






week 8 in review: galaxy s8 and lg g6 leaks galore


just before the floodgates of mwc announcements have opened, let's do a quick summary of what happened in the week leading up to the event.you don't need us to tell you that it's been a ongoing stream of rumors and revelations related to the stars of the hour - the lg g6 and the samsung galaxy s8, even if the latter isn't going to show up in barcelona. in the g6 folder we have at least one spy of the upcoming smartphone, leaked press renders, plus some official teasers - the full treatment.it may be a whole month away, but the galaxy s8 hasn't been spared either. detailed specs of both expected versions (the actual s8 and the s8+) have been outed and a bunch of live shots also made the rounds. there's a tiny bit of official data in the mix too - samsung revealed its next-gen in-hose chipse






sunday q&a - week 16


hello and welcome to the week 16 edition of our sunday q&a! this week we talk galaxy s8, sony xperia performance and xiaomi battery tests.peter: i am very much interested in buying the xperia x performance dual (64 gb). i heard it is only for the asian market - is that true? can i use it in europe?the sony xperia x performance dual is indeed mostly officially available in asian markets, but some european retailers are importing it so if you are willing to pay a bit of a premium you can still have it.its penta-band 3g and quad-band 2g support mean it will work anywhere in europe, while the lte band support is mostly identical so chances are you will getting 4g from the same carriers as with the regular version.that said, buying a unit not targeted to your market might cause some issues with






samsung galaxy s8 rumors: what to believe


image: samsungsamsung has dominated the android phone market for at least a half-decade, but the galaxy note 7 debacle last year lost the company goodwill with customers after its phones exploded in pants, hotel rooms, airplanes, and elsewhere.advertisementnow, in the wake of a global recall that will reportedly cost the company some $5 billion in profits, samsung needs a new smartphone hit. to get there, the south korean giant is depending on its reliably popular “galaxy s” smartphone series. recently, new iterations of the galaxy s phones have announced at mwc in barcelona, but this year samsung’s held off on announcing its new galaxy s phone at the conference.instead samsung sent out invitations for a special media event on march 29 in new york city, and based on the invitations, it’s s






samsung galaxy s8 rumors: what to believe [updated]


image: samsungsamsung has dominated the android phone market for at least a half-decade, but the galaxy note 7 debacle last year lost the company goodwill with customers after its phones exploded in pants, hotel rooms, airplanes, and elsewhere.advertisementnow, in the wake of a global recall that will reportedly cost the company some $5 billion in profits, samsung needs a new smartphone hit. to get there, the south korean giant is depending on its reliably popular “galaxy s” smartphone series. recently, new iterations of the galaxy s phones have announced at mwc in barcelona, but this year samsung’s held off on announcing its new galaxy s phone at the conference.instead samsung sent out invitations for a special media event on march 29 in new york city, and based on the invitations, it’s s






samsung galaxy s8 smartphone | rumors, news, specs, and more


samsung was riding high when the galaxy s7 officially outsold the iphone 6s and 6s plus, and even more so when the galaxy note 7 came along and impressed everyone — until it went out with a bang. it’s therefore likely to be thrilled to leave 2016 behind and turn its attention to this year’s flagship, which we know as the galaxy s8.lee jae-yong, samsung’s mobile communications vice president, has noted that, for starters, the galaxy s8 will “feature slick design and an improved camera, as well as an enhanced artificial intelligence service.” rumors say there may even be two — here’s everything you need to know.more: everything we think we know about the galaxy x, samsung’s rumored foldable phonesoftware: android nougatwith android 7.0 nougat already here, it’s almost certain that the galaxy






top 10 trending phones of week 43


these are exciting times for all smartphone enthusiasts - new phones are coming almost daily lately and two of these announcements had a serious impact on our trending phones chart this week. the oppo f5 leaped straight to the top, becoming the fourth different leader in the last four weeks, while the samsung galaxy j7 pro retained its second position. the xiaomi mi a1 rose a spot to get the bronze medal, just edging out the samsung galaxy note8. the iphone x went on pre-order, which helped it return to the top 10 and snatch the fifth spot, just ahead of last week's leader - nokia 7. another nokia is sitting in seventh - nokia 6, while the third new name on the chart is the newly unveiled sony xperia r1. xiaomi redmi note 4 took the ninth position in week 43, while the mate 10 pro just hel






top 10 trending phones of week 19


it was a relatively calm week in our top 10 chart with the top three remaining unchanged. that means the samsung galaxy s8 tops the list for the 7th week in a row, while the galaxy j7 prime and xiaomi redmi note 4 complete the rostrum.the larger member of the new samsung flagship duo - samsung galaxy s8+ surged to 4th, overtaking the xiaomi mi 6 in the process. the entry-level xiaomi redmi 4a claimed 6th, ahead of the samsung galaxy a5 (2017) and samsung galaxy s7 edge - all three gaining a spot thanks to the sony xperia xz premium which fell off the top 10. the two-and-a-half years old apple iphone 6 keeps defying expectations to land 9th spot and be the most popular smartphone by the cupertino company for yet another week. the final place on the chart is taken by xiaomi redmi 4x, making






samsung to build its own 1,000 fps camera to challenge sony


sony was the first to build a mobile camera with on-chip memory – the motion eye camera on the xperia xz premium and xzs (later xz1 too). now chatter from korea suggests that samsung semiconductors is looking to build a similar camera in november, ready to use in the next-generation galaxy s phone.the advantage of on-chip memory is that the camera can store many frames very fast – enough to shoot 1,000fps or so for slow-motion video. streaming those to the main ram will be too slow, so sony built a three layer chip – pixels, control logic and memory.samsung’s design is reportedly slightly different. it uses a traditional two layer chip to which a dram chip is bonded. apparently this is to avoid infringing certain patents.while samsung's design is not as sophisticated as sony's, the company






samsung galaxy s8 availability and prices leaked


samsung postponed its galaxy s8 launch and thus left more time for rumors to thrive. according to latest leaks from an industry insider, the galaxy s8 will come with era with dual adc, which should in theory enable better color depth. the same insider also revealed availability and prices for the device.according to the leakster south korea and china will get devices with 6gb ram and not the lesser ones with 4gb. at least the asian markets have the option to choose between 64gb or 128gb internal storage. the price for the 64gb galaxy s8 is going to be cny 6,088 (approx. $885) and the latter will be priced at cny 6,488 (about $943).europe and the rest of the world, on the other hand, will also have a third option - a galaxy s8 with 4gb ram and 64gb internal storage that we told you about ea






samsung galaxy s8 smartphone | rumors, news, specs, and more


samsung was riding high when the galaxy s7 officially outsold the iphone 6s and 6s plus, and even more so when the galaxy note 7 came along and impressed everyone — until it went out with a bang. it’s, therefore, likely to be thrilled to leave 2016 behind and turn its attention to this year’s flagship, which we know as the galaxy s8.lee jae-yong, samsung’s mobile communications vice president, has noted that, for starters, the galaxy s8 will “feature slick design and an improved camera, as well as an enhanced artificial intelligence service.” rumors say there may even be two — here’s everything you need to know.more: everything we think we know about the galaxy x, samsung’s rumored foldable phonedesign: next to no bezels and a button for bixbythe galaxy s8 has leaked once again, this time






samsung galaxy s8 smartphone | rumors, news, specs, and more


samsung was riding high when the galaxy s7 officially outsold the iphone 6s and 6s plus, and even more so when the galaxy note 7 came along and impressed everyone — until it went out with a bang. it’s, therefore, likely to be thrilled to leave 2016 behind and turn its attention to this year’s flagship, which we know as the galaxy s8.lee jae-yong, samsung’s mobile communications vice president, has noted that, for starters, the galaxy s8 will “feature slick design and an improved camera, as well as an enhanced artificial intelligence service.” rumors say there may even be two — here’s everything you need to know.more: everything we think we know about the galaxy x, samsung’s rumored foldable phonedesign: next to no bezels and a button for bixbywe’ve seen plenty of photo leaks pertaining to






galaxy s9 'unlikely' to be showcased at ces 2018, samsung says


last month, there were rumors that the next galaxy s series smartphones will be showcased a bit earlier than usual, at the consumer electronics show in january next year. however, samsung has now made the matter clear, saying that's "unlikely" to happen.samsung galaxy s8so now it's reasonable to assume the galaxy s9 and s9+ will either be officially unveiled in february during the mobile world congress (like the galaxy s5, s6, and s7), or at a dedicated event in march, like the galaxy s8 series.contrary to some reports so far, there are also rumors that the galaxy s9 won't feature an in-display fingerprint scanner.and finally, though there's currently no official confirmation on this, reports also say it's the foldable galaxy x phone that could be showcased by the south korean company duri






weekly poll results: the galaxy s8 is poised to outsell the galaxy s8 plus


the galaxy s7 edge outsold its smaller sibling, the s7. now leaked schematics show us that the next gen phones will have even bigger screen, will we see the galaxy s8 plus outsell the smaller galaxy s8?our preliminary polling says no - if our math is right, the smaller s8 will put an s7 edge-size screen into an s7-size body. and it won 35% of votes, leading the s8 plus (6.3” screen in an s7 edge body).of course, there are other considerations that might swing the results. the current consensus is that the galaxy s8 plus will have a dual era, while the s8 will not. however, the galaxy s8 will have stereo speakers while case designs for the plus model show only one speaker grill.it’s important to note that the s8 plus wasn’t second in the polls, it was the hypothetical 5.1” galaxy s8. samsun






top 10 trending phones of week 42


a trio of major announcements happened this week and one of the new phones is already leading the popularity chart. the nokia 7 might be a china-exclusive at this point but its value-for-money proposition is strong enough to get attention all around the globe. the mate 10 didn't do quite so well - despite being proper flagships only one of them made the top 10 - the vanilla mate 10 is sitting in third, right behind last week's leader, the samsung galaxy j7 pro. the xiaomi mi a1 has climbed a spot to claim fourth, while the galaxy note8 has slid a couple and is now sitting in fifth. nokia 6, xiaomi redmi note 4 and samsung galaxy j7 prime come up next, while the galaxy s8 and the xiaomi redmi 4 take the final two spots. the xioami redmi note 5 and mi mix 2 were the two phones to drop out of






samsung galaxy s8 smartphone | rumors, news, specs, and more


samsung was riding high when the galaxy s7 officially outsold the iphone 6s and 6s plus, and even more so when the galaxy note 7 came along and impressed everyone — until it went out with a bang. the firm is therefore likely to be thrilled to leave 2016 behind and turn its attention to this year’s flagship, which we know as the galaxy s8. lee jae-yong, samsung’s mobile communications vice president, has noted the galaxy s8 will “feature slick design and an improved camera, as well as an enhanced artificial intelligence service.” rumors say there may even be two models.it’s coming at the end of april, and although samsung chose not to officially reveal the galaxy s8 during mobile world congress at the end of february, local reports say some lucky executives did get to see the phone in secre






top 10 trending phones of week 18


it's been six consecutive weeks now that the samsung galaxy s8 has led our interest chart. the korean flagship is also showing no signs of slowing down, having nearly twice the daily hits of the second placed handset, which this week is the galaxy j7 prime.the xiaomi mi 6 lost some of its initial hype and rolled down to fourth, so the samsung mid-ranger was able to snatch the silver medal this time. somewhat surprisingly the redmi note 4 is the third device on the podium both the mi 6 and the samsung galaxy s8+ since last week.the galaxy s8+ has actually lost two positions and is now in sixth - right behind a new entry on the chart. the sony xperia xz premium is about to launch in europe and naturally interest in it is picking up, which helped it snatch the fifth spot. going further down t






why the iphone 8 is going to be very much like samsung’s new galaxy s8


the smartphone war between apple and samsung is heating up after the release of the galaxy s8. which looks very familiar if you’ve been following the latest iphone 8 rumors.in this week’s episode of the iphone show, i compare the actual samsung galaxy s8 with all the rumored features of the forthcoming iphone 8. if these rumors prove to be true, then both apple and samsung’s flagship phones will have an edge-to-edge display with a virtual home button. furthermore, the s8 and the iphone 8 will also share similar augmented reality and facial recognition technology.with all these presumed similarities, it’d be easy to say that apple is copying samsung. of course, it doesn’t matter who does it first, but who can do it better.according to the rumors, apple might have a few tricks up its sleeve






​samsung unveils customized enterprise versions of galaxy s8


samsung electronics has unveiled three new enterprise versions of the galaxy s8 and s8 plus that are customized for local partners and their customers.the south korean tech giant introduced the galaxy s8 hanacard, galaxy s8 shinsegae, and galaxy s8 k-bank editions of the phones at its press conference in south korea.the phones are knox-customized for increased security and have ui and ux catered to the partnered companies' needs.the hanacard edition allows the use of membership points offered by the credit card company, and customers can check their payment schedules and make mobile payments. the shinsegae edition is for use of the retailer's employees.the k-bank edition is catered to its namesake internet bank's services such as opening accounts and transferring money.senior executives of






htc u11 vs. iphone 7 plus vs. xperia xz premium: camera shootout


introductiona few weeks ago, we offered you a dramatic standoff between the lg g6, samsung galaxy s8, and the sony xperia xz premium. we followed that up with a head-to-head between the samsung galaxy s8+ and htc u11 cameras. today, we pit the htc u11 against the sony xperia xz premium and the iphone 7 plus in another camera-centric duel - and this time, it's a triple one.the responses to our lg g6 vs. samsung galaxy s8 vs. sony xperia xz premium comparison were definitely "varied", for a lack of a better term. some obligatory bickering aside, it was really encouraging to see such a heated and educated discussion on the topic among you, our readers.there was a second theme that prevailed in the comment section - you wanted to see more. the u11 review unit was only available to us for a lim






htc u11 vs. iphone 7 plus vs. xperia xz premium: camera shootout


introductiona few weeks ago, we offered you a dramatic standoff between the lg g6, samsung galaxy s8, and the sony xperia xz premium. we followed that up with a head-to-head between the samsung galaxy s8+ and htc u11 cameras. today, we pit the htc u11 against the sony xperia xz premium and the iphone 7 plus in another camera contest - and it's a three-horse race again.the responses to our lg g6 vs. samsung galaxy s8 vs. sony xperia xz premium comparison were definitely "varied", for the lack of a better term. the usual bickering aside, it was really encouraging to see such an energetic and educated discussion by our readers.there was a second theme that prevailed in the comment section - you wanted to see more. the u11 review unit was only available to us for a limited time and we hardly g






htc u11 vs. iphone 7 plus vs. xperia xz premium: camera shootout


introductiona few weeks ago, we offered you a dramatic standoff between the lg g6, samsung galaxy s8, and the sony xperia xz premium. we followed that up with a head-to-head between the samsung galaxy s8+ and htc u11 cameras. today, we pit the htc u11 against the sony xperia xz premium and the iphone 7 plus in another camera contest - and it's a three-horse race again.the responses to our lg g6 vs. samsung galaxy s8 vs. sony xperia xz premium comparison were definitely "varied", for the lack of a better term. the usual bickering aside, it was really encouraging to see such a high-pitched and educated discussion by our readers.there was a second theme that prevailed in the comment section - you wanted to see more. the u11 review unit was only available to us for a limited time and we hardly






galaxy s9 mini coming in march alongside s9 and s9+, rumor claims


while rumors of a samsung galaxy s8 mini never panned out, perhaps next year's going to be the lucky one for people looking for a diminutive flagship smartphone that isn't made by sony. a new report coming from some unnamed sources claims that samsung is working on a galaxy s9 mini, a handset that should debut alongside the s9 and s9+ in march 2018.the s9 mini will allegedly have a screen under 5" in size, with curved edges. there's no information about what aspect ratio it will have, but if samsung sticks with 18.5:9 (as seen in the s8, s8+, and note8) then this will indeed be a tiny device.no spec details have been uncovered yet, but the rumored launch happening at the same time as the s9 and s9+ strongly implies that the s9 mini might have top of the line innards too, like those phones.






samsung galaxy s8 active appears on geekbench


samsung is working on a galaxy s8 active, and it looks like the device is in nearing release after a benchmark scorecard appeared on the geekbench website. the device with the model number sm-g892a got 1842 in single-core and 6394 in the multi-core tests.according to the listing, the samsung device will run the snapdragon 835 with android nougat 7.0.compared to other phones with the latest qualcomm soc, the galaxy s8 active is behind the galaxy s8 and the xiaomi mi 6, on par with htc u11 and the galaxy s8+ with snapdragon 835, and ahead of the sony xperia xz premium. differences are pretty minor though, as you can imagine.the galaxy s8 active is expected to have the same hardware specs as the galaxy s8. it will lack the curved edges of the infinity display but will sport a rugged body for






8 ways the iphone 8 can beat the galaxy s8


if there wasn’t already a mountain of pressure on apple to deliver something spectacular with this year’s iphone update, there surely is now. if you haven’t noticed, samsung has released the galaxy s8 and s8+, and they’re pretty remarkable. as a former iphone 7 plus user, the s8+ might very well be the best phone i’ve ever used, with a stunning screen, speedy processor, and, yes, a gorgeous design.but what makes the s8 so amazing is how unique it is. i got to spend a week with it while writing my review, and i came away stunned. for the first time in a while, samsung is standing alone on the cutting edge with a phone that needs to be seen to be believed. from its barely there bezels to its brilliant wraparound screen, the galaxy s8 truly gives apple a run for its money. no joke, it actuall






8 ways the iphone 8 can beat the galaxy s8


if there wasn’t already a mountain of pressure on apple to deliver something spectacular with this year’s iphone update, there surely is now. if you haven’t noticed, samsung has released the galaxy s8 and s8+, and they’re pretty remarkable. as a former iphone 7 plus user, the s8+ might very well be the best phone i’ve ever used, with a stunning screen, speedy processor, and, yes, a gorgeous design.but what makes the s8 so amazing is how unique it is. i got to spend a week with it while writing my review, and i came away stunned. for the first time in a while, samsung is standing alone on the cutting edge with a phone that needs to be seen to be believed. from its barely there bezels to its brilliant wraparound screen, the galaxy s8 truly gives apple a run for its money. no joke, it actuall






breach site leakedsource apparently raided by feds


image: file leakedsource, a for-profit breach notification site that helped break the news of some of last year's largest data breaches, has apparently been raided by law enforcement. news of the raid, which can't be confirmed at the time of writing, first broke on thursday through a note posted on a virtual markets forum earlier in the day, but it is no longer viewable. leakedsource's website appears to have been pulled offline. the note reads: "yeah you heard it here first. sorry for all you kids who don't have all your own databases. leakedsource is down forever and won't be coming back. owner raided early this morning. wasn't arrested, but all ssd's got taken, and leakedsource servers got subpoena'd and placed under federal investigation. if somehow he recovers from this and launches